(data stored in ACNUC7421 zone)

EMBL: CP001349.PE303

CP001349.PE303       Location/Qualifiers
FT   CDS             complement(353037..353660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55355"
FT                   /db_xref="GOA:B8IAW2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW2"
FT                   /inference="similar to AA sequence:KEGG:M446_2295"
FT                   /protein_id="ACL55355.1"
FT                   /translation="MSTGPSVPSAGTPPDRLTAMSAVLARNWWLVALRGVFAILFGIIA
FT                   LVSPIATLYTLVIFFAAYMLVDGIADIVAAVRAAERHERWGLLLAEGILDILVGIVAFL
FT                   VPGSALLAFVYLTAAWALVTGALMIAAAFRLHLDHGRWWLVLGGVCSVLFGIALLINPG
FT                   VSLLVLTYWLAGYAIAFGVLMLILAFRLRSRHAEALPPSAARPA"
     MSTGPSVPSA GTPPDRLTAM SAVLARNWWL VALRGVFAIL FGIIALVSPI ATLYTLVIFF        60
     AAYMLVDGIA DIVAAVRAAE RHERWGLLLA EGILDILVGI VAFLVPGSAL LAFVYLTAAW       120
     ALVTGALMIA AAFRLHLDHG RWWLVLGGVC SVLFGIALLI NPGVSLLVLT YWLAGYAIAF       180
     GVLMLILAFR LRSRHAEALP PSAARPA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page