(data stored in ACNUC7421 zone)

EMBL: CP001349.PE304

CP001349.PE304       Location/Qualifiers
FT   CDS             353875..355077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0312"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   mrd:Mrad2831_3613 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55356"
FT                   /db_xref="GOA:B8IAW3"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW3"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACL55356.1"
FT                   /translation="MLDDQSGAEHRDGRSPDAPAARNRADLPRSHDATPSPDREPERTG
FT                   SSRDGRGGRGEKTPSPIRRHPVWFALGAILLVATGAAGFWYWLVFVHPYESTDDAFVAA
FT                   RQFSVAPKVSGYVVAVPVTDNQHVEAGSVLFQIDRRDYAAALREAQAQVASAEAAIRNI
FT                   DAQIEAQRGSIAEAEAQVEQADAALAFARQEAARYQDLAQRGAGSIQQSQQSTSNLQQQ
FT                   QANLSRARAAVTVAQKQVGSLQAQRAGAEASLAQARAQEEQARLNLGYTTVTAAQAGRV
FT                   VRLTGAVGQYAQAGQALGMFVPDDIWITANFKETQITDMRPGQDVDVEIDAYPDRTIKG
FT                   RVESVQPGSGTAFSLLPAENATGNFVKVVQRVPVKIVVDHWPEDVAIGPGLSVVPTVRV
FT                   R"
     MLDDQSGAEH RDGRSPDAPA ARNRADLPRS HDATPSPDRE PERTGSSRDG RGGRGEKTPS        60
     PIRRHPVWFA LGAILLVATG AAGFWYWLVF VHPYESTDDA FVAARQFSVA PKVSGYVVAV       120
     PVTDNQHVEA GSVLFQIDRR DYAAALREAQ AQVASAEAAI RNIDAQIEAQ RGSIAEAEAQ       180
     VEQADAALAF ARQEAARYQD LAQRGAGSIQ QSQQSTSNLQ QQQANLSRAR AAVTVAQKQV       240
     GSLQAQRAGA EASLAQARAQ EEQARLNLGY TTVTAAQAGR VVRLTGAVGQ YAQAGQALGM       300
     FVPDDIWITA NFKETQITDM RPGQDVDVEI DAYPDRTIKG RVESVQPGSG TAFSLLPAEN       360
     ATGNFVKVVQ RVPVKIVVDH WPEDVAIGPG LSVVPTVRVR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page