(data stored in ACNUC7421 zone)

EMBL: CP001349.PE305

CP001349.PE305       Location/Qualifiers
FT   CDS             355074..356669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0313"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mrd:Mrad2831_3614
FT                   EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55357"
FT                   /db_xref="GOA:B8IAW4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW4"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACL55357.1"
FT                   /translation="MSAPDPADSAAGGHNPWLVAVVVAIATFMEVLDTTIANVALRYIS
FT                   GGLAVGPDEAAWVVTSYLVANAIVLTASSFVAKRYGRKAFFMAAIALFTVSSILCGFAW
FT                   SLESLLVFRVLQGLGGGGMAPLAQSILADSFPPEKRGQAFALYGIAIVVAPVVGPTLGG
FT                   WLSDTYSWHWCFLINAPVGVIALGLIHLLVQDPKSAIEERERLRREGVDFDLVGFVLVA
FT                   TFLGSLEVVLDQGQRKDWFGSNLIVTFAVFMGIAFAAIIPWELTRRNPVVDLRLLGRRQ
FT                   FGSCFLVMMATGAILIATTQFLPQLLQDHFGYTATWAGLALSPGGLVTCLMMFVIGRIA
FT                   SVVQPKYLIAGGAAIIAVAMVDLTNLYGDLDFGFFVWSRIAIGIGLPMIFLSITAASYE
FT                   GIAPAQTDQASALINVARNVGGSMGVSLAQNMLAYRQQFHTSRLVEHVVPSEPAYQETL
FT                   RHATDYFATHGASTVDAQSQAFAWIGQQVQTQSAFLAYIDVFWTLAMVSAATIPLAMIL
FT                   TSVKRRGGAPATGH"
     MSAPDPADSA AGGHNPWLVA VVVAIATFME VLDTTIANVA LRYISGGLAV GPDEAAWVVT        60
     SYLVANAIVL TASSFVAKRY GRKAFFMAAI ALFTVSSILC GFAWSLESLL VFRVLQGLGG       120
     GGMAPLAQSI LADSFPPEKR GQAFALYGIA IVVAPVVGPT LGGWLSDTYS WHWCFLINAP       180
     VGVIALGLIH LLVQDPKSAI EERERLRREG VDFDLVGFVL VATFLGSLEV VLDQGQRKDW       240
     FGSNLIVTFA VFMGIAFAAI IPWELTRRNP VVDLRLLGRR QFGSCFLVMM ATGAILIATT       300
     QFLPQLLQDH FGYTATWAGL ALSPGGLVTC LMMFVIGRIA SVVQPKYLIA GGAAIIAVAM       360
     VDLTNLYGDL DFGFFVWSRI AIGIGLPMIF LSITAASYEG IAPAQTDQAS ALINVARNVG       420
     GSMGVSLAQN MLAYRQQFHT SRLVEHVVPS EPAYQETLRH ATDYFATHGA STVDAQSQAF       480
     AWIGQQVQTQ SAFLAYIDVF WTLAMVSAAT IPLAMILTSV KRRGGAPATG H                531
//

If you have problems or comments...

PBIL Back to PBIL home page