(data stored in ACNUC7421 zone)

EMBL: CP001349.PE306

CP001349.PE306       Location/Qualifiers
FT   CDS             356747..357694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0314"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   met:M446_2294 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55358"
FT                   /db_xref="GOA:B8IAW5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACL55358.1"
FT                   /translation="MNQSGSRFVIYAALAGNLAIAATKLMAALYTGSSAMFTEAVHSFV
FT                   DTGNQGLLLYGLHRAARPADDSHNFGHGLELYFWSFVVALMIFALGGAYAIYEGIEKIR
FT                   HPHPIEAAWVNVAVIGTALVFEGLSFLAAWREMRHRFARLPLWRAVARSKDPSTFAVVL
FT                   EDGAALIGLGFALAGIVGSTWLGRPQSDGVASVAIGLLLVATAMVLFRETRSLLTGESA
FT                   SPRLIEQATAILRSDPRVLGVPRLRSLHLGPTTVLLAASLDLDRDLSAEGIRHAVGDLR
FT                   GAIRHGLPGVELLLELREAEAVASSDRGAIPARP"
     MNQSGSRFVI YAALAGNLAI AATKLMAALY TGSSAMFTEA VHSFVDTGNQ GLLLYGLHRA        60
     ARPADDSHNF GHGLELYFWS FVVALMIFAL GGAYAIYEGI EKIRHPHPIE AAWVNVAVIG       120
     TALVFEGLSF LAAWREMRHR FARLPLWRAV ARSKDPSTFA VVLEDGAALI GLGFALAGIV       180
     GSTWLGRPQS DGVASVAIGL LLVATAMVLF RETRSLLTGE SASPRLIEQA TAILRSDPRV       240
     LGVPRLRSLH LGPTTVLLAA SLDLDRDLSA EGIRHAVGDL RGAIRHGLPG VELLLELREA       300
     EAVASSDRGA IPARP                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page