(data stored in ACNUC7421 zone)

EMBL: CP001349.PE307

CP001349.PE307       Location/Qualifiers
FT   CDS             357805..359547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0315"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: ferredoxin; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; KEGG: met:M446_2293
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55359"
FT                   /db_xref="GOA:B8IAW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW6"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55359.1"
FT                   /translation="MALVMPAARAAGHAPSGSTVRLWRGSVAQRLRLVSGLILFAFAAT
FT                   HFLNHALGLFGIEAMLAFERWRATVTRSVPGTALLAGALLVHAGLALRKLAARRSLRLP
FT                   AWEAAQIVLGLAIPFLLVPHILGTRVANLLYGLNTSYPTVIAHLWPDAIPRQTLLLTLV
FT                   WAHGCLGLHHWLRLSPGYRRAAPWLGVAALILPLAAMLGIAMQGELMERDLAAAARFDA
FT                   ADLAQRWPQYRPPEALTGLGTPIIAGFYAASGLALALGLVRMTAAWRARRIAVTYLDGP
FT                   SVRAADGMTLLEVSRAHRIPHVAVCGGRGRCSTCRVLVTRGTHNLSPPSAQETATLTAI
FT                   GAPPGVRLACQARPRGEVTLMRILRPGTRDRTGDRLGDPDLAGVEREVAILFVDVRGFT
FT                   PLAERKFAFDVVYILNRFFEAAGEPVVKHGGWIGGYAGDGLLALFTHPDGIDAACRAAF
FT                   AAAADIDRAVQALNRQIAAELPAPLRIAMGLHAGPLVLGRLGYGESRPMSAIGPAVNIA
FT                   SRLETHAKAHEVQLAASAAAARRAGIPLDGLRVETVAIRGSEQALEVVSVERAGDLAGR
FT                   LPAA"
     MALVMPAARA AGHAPSGSTV RLWRGSVAQR LRLVSGLILF AFAATHFLNH ALGLFGIEAM        60
     LAFERWRATV TRSVPGTALL AGALLVHAGL ALRKLAARRS LRLPAWEAAQ IVLGLAIPFL       120
     LVPHILGTRV ANLLYGLNTS YPTVIAHLWP DAIPRQTLLL TLVWAHGCLG LHHWLRLSPG       180
     YRRAAPWLGV AALILPLAAM LGIAMQGELM ERDLAAAARF DAADLAQRWP QYRPPEALTG       240
     LGTPIIAGFY AASGLALALG LVRMTAAWRA RRIAVTYLDG PSVRAADGMT LLEVSRAHRI       300
     PHVAVCGGRG RCSTCRVLVT RGTHNLSPPS AQETATLTAI GAPPGVRLAC QARPRGEVTL       360
     MRILRPGTRD RTGDRLGDPD LAGVEREVAI LFVDVRGFTP LAERKFAFDV VYILNRFFEA       420
     AGEPVVKHGG WIGGYAGDGL LALFTHPDGI DAACRAAFAA AADIDRAVQA LNRQIAAELP       480
     APLRIAMGLH AGPLVLGRLG YGESRPMSAI GPAVNIASRL ETHAKAHEVQ LAASAAAARR       540
     AGIPLDGLRV ETVAIRGSEQ ALEVVSVERA GDLAGRLPAA                             580
//

If you have problems or comments...

PBIL Back to PBIL home page