(data stored in ACNUC7421 zone)

EMBL: CP001349.PE309

CP001349.PE309       Location/Qualifiers
FT   CDS             361188..362360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0317"
FT                   /product="methyltransferase type 11"
FT                   /note="KEGG: met:M446_2289 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55361"
FT                   /db_xref="GOA:B8IAW8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW8"
FT                   /inference="similar to AA sequence:KEGG:M446_2289"
FT                   /protein_id="ACL55361.1"
FT                   /translation="MIPFGLVSPQSGEALHHDTPHSLREGRLGPRWPVIDGIPYLRVGR
FT                   DDLVREALGHLDKGAPGHALEQLLADQDDGWTGPRPDPAQLRELVRDLKYVSLREAVAR
FT                   LAWGEVGDYFVHRWTDPTFLAGLALLEAHWNAPLCVFELACGIGHYLRELQGRGVRTSG
FT                   ADVVFAKLWVARHWVVGQRAQLLCFDAGSPHWPIEGTPVDLVLCNDAFSLLKDKSCILD
FT                   CLRRTAGEEGWLALSHIHNSARAGFSAGHAVSAAEIEELFPDGLVYDDAELTHALVEAR
FT                   APAPAEPSALGAVEAFSVVCGPGMRPAPRALVDGLTLPPDGTQLRLNPLYRPMPEGDYA
FT                   IAWPSERYAAEYGPFATYPMRSPGPETIVAGPDTAERARRREFASLPERW"
     MIPFGLVSPQ SGEALHHDTP HSLREGRLGP RWPVIDGIPY LRVGRDDLVR EALGHLDKGA        60
     PGHALEQLLA DQDDGWTGPR PDPAQLRELV RDLKYVSLRE AVARLAWGEV GDYFVHRWTD       120
     PTFLAGLALL EAHWNAPLCV FELACGIGHY LRELQGRGVR TSGADVVFAK LWVARHWVVG       180
     QRAQLLCFDA GSPHWPIEGT PVDLVLCNDA FSLLKDKSCI LDCLRRTAGE EGWLALSHIH       240
     NSARAGFSAG HAVSAAEIEE LFPDGLVYDD AELTHALVEA RAPAPAEPSA LGAVEAFSVV       300
     CGPGMRPAPR ALVDGLTLPP DGTQLRLNPL YRPMPEGDYA IAWPSERYAA EYGPFATYPM       360
     RSPGPETIVA GPDTAERARR REFASLPERW                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page