(data stored in ACNUC7421 zone)

EMBL: CP001349.PE31

CP001349.PE31        Location/Qualifiers
FT   CDS             31804..32214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0032"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: met:M446_0030 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55083"
FT                   /db_xref="GOA:B8IT21"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT21"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACL55083.1"
FT                   /translation="MARVTVEDCIDKVENRFELVLLAGHRARLLSSGAPLTVDRDRDKN
FT                   PVVALREIADQTITPDDLKEQLIHSLQKYVEVDEPEAEAVPLLSSSPAAAAVAPQSSGD
FT                   DGDIQFDRMSEEDLLRGLENLAPPTETEDEGD"
     MARVTVEDCI DKVENRFELV LLAGHRARLL SSGAPLTVDR DRDKNPVVAL REIADQTITP        60
     DDLKEQLIHS LQKYVEVDEP EAEAVPLLSS SPAAAAVAPQ SSGDDGDIQF DRMSEEDLLR       120
     GLENLAPPTE TEDEGD                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page