(data stored in ACNUC7421 zone)

EMBL: CP001349.PE310

CP001349.PE310       Location/Qualifiers
FT   CDS             complement(362424..363380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2283 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55362"
FT                   /db_xref="GOA:B8IAW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55362.1"
FT                   /translation="MRNLSLKQLQAVAAIARLGTMTRAAQELNVTPAALTARIKALEDE
FT                   AGLLLFDRTSAGLKPTDAGREMLWAIDSINTVLETCAERLKALRGGSGGRVAVGVVSTA
FT                   KYFAPQIISGFVHQHPSIEIDLVVGNRGATLESIRDYKVDLAVMGRPPRDFPISAESFG
FT                   PHPLVVIAAPGHRFAGRVGITRAELAEEPFLVREYGSGTRTVFEEFMTGVMIKRARFGI
FT                   DSGSNETIKQTVMAGLGIALISGHTVAAEVASRRLIILDVEGLPIRREWFVVRRADKVL
FT                   SPAARSLWDYIVTEGASWLPTLPLRPPGAPAGATAAA"
     MRNLSLKQLQ AVAAIARLGT MTRAAQELNV TPAALTARIK ALEDEAGLLL FDRTSAGLKP        60
     TDAGREMLWA IDSINTVLET CAERLKALRG GSGGRVAVGV VSTAKYFAPQ IISGFVHQHP       120
     SIEIDLVVGN RGATLESIRD YKVDLAVMGR PPRDFPISAE SFGPHPLVVI AAPGHRFAGR       180
     VGITRAELAE EPFLVREYGS GTRTVFEEFM TGVMIKRARF GIDSGSNETI KQTVMAGLGI       240
     ALISGHTVAA EVASRRLIIL DVEGLPIRRE WFVVRRADKV LSPAARSLWD YIVTEGASWL       300
     PTLPLRPPGA PAGATAAA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page