(data stored in ACNUC7421 zone)

EMBL: CP001349.PE311

CP001349.PE311       Location/Qualifiers
FT   CDS             363581..364573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0319"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: met:M446_2282
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55363"
FT                   /db_xref="GOA:B8IAX0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX0"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ACL55363.1"
FT                   /translation="MVVGTRLEACLASEGAGGDRAVASVLTALALAAAETSTLLRNGGH
FT                   DSGPGPNGLEGAVRSRFTAALRDAPTALLALREAEHDEVLDPAASLAVALSPLDGADNL
FT                   AGNLPAGTIFSLRPAGDGAPFRQPGRSQVAAGFVTYGPRTDLALTWGRGVRIFTLDPAS
FT                   GAFHLTRDAVTIPPTSPLYAVDAANARFWEAPVRAFVDDCLRGSEGPRGQDFAMGWSTS
FT                   LAAGAHHILARGGVQLMPGETRRGCANGQTRLVHEAAAIALVMEAAGGAATDGRDGPIL
FT                   DLKALDLHQRTPFVFGSAEEVACVGKYHDGRRHTGARSPLFGQRGLLRA"
     MVVGTRLEAC LASEGAGGDR AVASVLTALA LAAAETSTLL RNGGHDSGPG PNGLEGAVRS        60
     RFTAALRDAP TALLALREAE HDEVLDPAAS LAVALSPLDG ADNLAGNLPA GTIFSLRPAG       120
     DGAPFRQPGR SQVAAGFVTY GPRTDLALTW GRGVRIFTLD PASGAFHLTR DAVTIPPTSP       180
     LYAVDAANAR FWEAPVRAFV DDCLRGSEGP RGQDFAMGWS TSLAAGAHHI LARGGVQLMP       240
     GETRRGCANG QTRLVHEAAA IALVMEAAGG AATDGRDGPI LDLKALDLHQ RTPFVFGSAE       300
     EVACVGKYHD GRRHTGARSP LFGQRGLLRA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page