(data stored in ACNUC7421 zone)

EMBL: CP001349.PE312

CP001349.PE312       Location/Qualifiers
FT   CDS             364666..365526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0320"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   met:M446_2281 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55364"
FT                   /db_xref="GOA:B8IAX1"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX1"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ACL55364.1"
FT                   /translation="MSALHPIISVTGSSGAGTTSVRNTFEQIFRRESVTAVYIEGDAFH
FT                   SMDRATMRKAMAAEPTLSHFGERANLLPELEAVFRAYAESGRGRTRHYIHDRNDAERWG
FT                   GEPGTFSEWEEFDAESDLLFYEGLHGAVHNERINIAQYADLKIGVVPVINLEWIQKLHR
FT                   DRATRGYSTEAVTDVILRRMPDYVNVICPQFTNTDINFQRIPTVDTSNPFIARWIPTAD
FT                   ESMVVIRFRDPKGIDFPYLISMIAGSFMSRANSVVIPGGKLDLAMQLILTPMILQLVER
FT                   RRRLL"
     MSALHPIISV TGSSGAGTTS VRNTFEQIFR RESVTAVYIE GDAFHSMDRA TMRKAMAAEP        60
     TLSHFGERAN LLPELEAVFR AYAESGRGRT RHYIHDRNDA ERWGGEPGTF SEWEEFDAES       120
     DLLFYEGLHG AVHNERINIA QYADLKIGVV PVINLEWIQK LHRDRATRGY STEAVTDVIL       180
     RRMPDYVNVI CPQFTNTDIN FQRIPTVDTS NPFIARWIPT ADESMVVIRF RDPKGIDFPY       240
     LISMIAGSFM SRANSVVIPG GKLDLAMQLI LTPMILQLVE RRRRLL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page