(data stored in ACNUC7421 zone)

EMBL: CP001349.PE313

CP001349.PE313       Location/Qualifiers
FT   CDS             365602..366396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0321"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bcj:BCAM2003 AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55365"
FT                   /db_xref="GOA:B8IAX2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX2"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACL55365.1"
FT                   /translation="MHRAEQFRSAVTGIEAVALASRRHFPRHAHDHFGIGVMRFGAHRS
FT                   WSGIGPVEAGAGDVITVNPGEMHDGHPVDDRGRGWTMLYLDPGLMAREMRDETPGPFEI
FT                   TRPAVSDPGLADSLTRLFAGMIAPKPDLLALEERLLRTLMLLLRRYANRFPPVREASPP
FT                   VARALRRLNEAPEIPVTLGELAALSGVSRFQLLRGFSREVGTTPHSYLIQRRVRLARQL
FT                   LAAGQRPAEAAIAAGFADQSHMTRAFVRQFGVTPARYRSAVA"
     MHRAEQFRSA VTGIEAVALA SRRHFPRHAH DHFGIGVMRF GAHRSWSGIG PVEAGAGDVI        60
     TVNPGEMHDG HPVDDRGRGW TMLYLDPGLM AREMRDETPG PFEITRPAVS DPGLADSLTR       120
     LFAGMIAPKP DLLALEERLL RTLMLLLRRY ANRFPPVREA SPPVARALRR LNEAPEIPVT       180
     LGELAALSGV SRFQLLRGFS REVGTTPHSY LIQRRVRLAR QLLAAGQRPA EAAIAAGFAD       240
     QSHMTRAFVR QFGVTPARYR SAVA                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page