(data stored in ACNUC7421 zone)

EMBL: CP001349.PE314

CP001349.PE314       Location/Qualifiers
FT   CDS             366476..367282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0322"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; methyltransferase
FT                   small; Methyltransferase type 11; Methyltransferase type
FT                   12; KEGG: gur:Gura_0628 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55366"
FT                   /db_xref="GOA:B8IAX3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55366.1"
FT                   /translation="MDQHYVHGYDGVESLRLHDQASTLEDLLHGDTAYPGGSTILEAGC
FT                   GVGAQTVALARRNPGVKITCVDVSARSLMTAEAHVAAAGLPRPDFRQADLHALPFSEAS
FT                   FDHVFVCFVLEHLARPARALAELRRVVKPNGTITVIEGDHGSTFFHPDDSDARAVIRCQ
FT                   VDLQRAAGGDALIGRRLFPLLAQSGFDAVRVSPRLVYVDASRPNLAEGFVRKTFTAMIA
FT                   GIRSPATAANLIDGATFDSGIRALLRTSEADGVFCYTFFKAVGRKA"
     MDQHYVHGYD GVESLRLHDQ ASTLEDLLHG DTAYPGGSTI LEAGCGVGAQ TVALARRNPG        60
     VKITCVDVSA RSLMTAEAHV AAAGLPRPDF RQADLHALPF SEASFDHVFV CFVLEHLARP       120
     ARALAELRRV VKPNGTITVI EGDHGSTFFH PDDSDARAVI RCQVDLQRAA GGDALIGRRL       180
     FPLLAQSGFD AVRVSPRLVY VDASRPNLAE GFVRKTFTAM IAGIRSPATA ANLIDGATFD       240
     SGIRALLRTS EADGVFCYTF FKAVGRKA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page