(data stored in ACNUC7421 zone)

EMBL: CP001349.PE315

CP001349.PE315       Location/Qualifiers
FT   CDS             367377..368153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0323"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: met:M446_2280 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55367"
FT                   /db_xref="GOA:B8IAX4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACL55367.1"
FT                   /translation="MLKALIFDVDGTLAETEPVHRESFNRAFARFGLPFSWDEALYADL
FT                   LQVTGGKERLLHYLAHYRPPGVEGIFPLLPEIYAAKTRAYVELVAAGRLVPRPGILRLV
FT                   AEAKAAGLRLAIATTSHADNVAALIAALFRTGRGPFDLVAAGDAVTAKKPSPAVYDFAL
FT                   ARLGVAATEAVAFEDSTNGVRAARAAGLPVVATPSQALPVDDLGEAPAIVSDLGEPGLP
FT                   HRLLAGDPWPAGMVSVDALHGWHARQAAACPVEGMA"
     MLKALIFDVD GTLAETEPVH RESFNRAFAR FGLPFSWDEA LYADLLQVTG GKERLLHYLA        60
     HYRPPGVEGI FPLLPEIYAA KTRAYVELVA AGRLVPRPGI LRLVAEAKAA GLRLAIATTS       120
     HADNVAALIA ALFRTGRGPF DLVAAGDAVT AKKPSPAVYD FALARLGVAA TEAVAFEDST       180
     NGVRAARAAG LPVVATPSQA LPVDDLGEAP AIVSDLGEPG LPHRLLAGDP WPAGMVSVDA       240
     LHGWHARQAA ACPVEGMA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page