(data stored in ACNUC7421 zone)

EMBL: CP001349.PE316

CP001349.PE316       Location/Qualifiers
FT   CDS             368195..369391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0324"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; KEGG: met:M446_2279 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55368"
FT                   /db_xref="GOA:B8IAX5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX5"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACL55368.1"
FT                   /translation="MCGFLSMSGEWSNRDMAESGRAELPYRLRQQGFLGSLTRMLLQSR
FT                   DLGAFLQRACDAAAEGLGAPCAHVLEYRPHDHDFLIRAATGWPEGTIGATCPAADEAAP
FT                   AAYAFRTGAGVLANGLPDTAGFRLPDPFGGAGIRHAVNVPIVLGEDGRRAYGVLEVCGR
FT                   EDPGFDRADQDFLAGLAGLIGLAVERSHADQRLRDALDHQALLAREMSHRVKNSLGVVA
FT                   GLLRLQARDTHSEEVRYALEDAGARIATVAQVHDHLWRGLHVGTVEVSGFVRELVSKLQ
FT                   EAAPGHPLRCEADPRVIAADQAIPIGLMVNELVTNAVKYAYPGGTGPVEVTVAVQGNRL
FT                   RVDVSDHGVGLPPGFDVHSRQRSLGLKIINNLTRQLDGRLSAEPNNPGARFVLEMPLG"
     MCGFLSMSGE WSNRDMAESG RAELPYRLRQ QGFLGSLTRM LLQSRDLGAF LQRACDAAAE        60
     GLGAPCAHVL EYRPHDHDFL IRAATGWPEG TIGATCPAAD EAAPAAYAFR TGAGVLANGL       120
     PDTAGFRLPD PFGGAGIRHA VNVPIVLGED GRRAYGVLEV CGREDPGFDR ADQDFLAGLA       180
     GLIGLAVERS HADQRLRDAL DHQALLAREM SHRVKNSLGV VAGLLRLQAR DTHSEEVRYA       240
     LEDAGARIAT VAQVHDHLWR GLHVGTVEVS GFVRELVSKL QEAAPGHPLR CEADPRVIAA       300
     DQAIPIGLMV NELVTNAVKY AYPGGTGPVE VTVAVQGNRL RVDVSDHGVG LPPGFDVHSR       360
     QRSLGLKIIN NLTRQLDGRL SAEPNNPGAR FVLEMPLG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page