(data stored in ACNUC7421 zone)

EMBL: CP001349.PE317

CP001349.PE317       Location/Qualifiers
FT   CDS             369574..370515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0325"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; NMT1/THI5 like domain protein;
FT                   KEGG: met:M446_2277 NMT1/THI5-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55369"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX6"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACL55369.1"
FT                   /translation="MRAAAIGMGLAALLAAPAFAQGTKVTIGMSGWTGFAPLTLAKEAG
FT                   IFQKNGLDVTIKKIPQASRHLAIRSGDVQCAATTVETWVVWNANGVPAKQIFQLDKSYG
FT                   ADGLVVRNDIAAIKDLKGKTVAASVPGTAPYFTLAWMLKQNGLSLKDVKVVNLEPGPAA
FT                   QAFIAGQNDAAVTYEPYLSSVRAAPQAGKIIATTLDYPMIMDTFGCTPDFLNQNPKAAK
FT                   ALADSYFEALDLIAKDQAKSFEIMGADVKQTGEAFAASAKFLRWQDRAANKAFFSGGLQ
FT                   KFSAEAADLLLEIGIIKQKPDIDSLADARFIQ"
     MRAAAIGMGL AALLAAPAFA QGTKVTIGMS GWTGFAPLTL AKEAGIFQKN GLDVTIKKIP        60
     QASRHLAIRS GDVQCAATTV ETWVVWNANG VPAKQIFQLD KSYGADGLVV RNDIAAIKDL       120
     KGKTVAASVP GTAPYFTLAW MLKQNGLSLK DVKVVNLEPG PAAQAFIAGQ NDAAVTYEPY       180
     LSSVRAAPQA GKIIATTLDY PMIMDTFGCT PDFLNQNPKA AKALADSYFE ALDLIAKDQA       240
     KSFEIMGADV KQTGEAFAAS AKFLRWQDRA ANKAFFSGGL QKFSAEAADL LLEIGIIKQK       300
     PDIDSLADAR FIQ                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page