(data stored in ACNUC7421 zone)

EMBL: CP001349.PE318

CP001349.PE318       Location/Qualifiers
FT   CDS             370521..371294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0326"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2276
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55370"
FT                   /db_xref="GOA:B8IAX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55370.1"
FT                   /translation="MRPLQPVGRVPRAVLGVGFFVLFVLAWAVATLGGFVPVTFLADPL
FT                   TMLQDGWLLLTRFGFLSDIGVTVWRVVGGFLLAAVVAVPLGILMGAYKPVEAFFEPFVS
FT                   FARYLPASAFVPLLILWAGIGEMQKLLVIFIGSVFQIVLMVAVSVGQVRRDLVEAAYTL
FT                   GASDTGIIRRVLIPATAPDIAEILRLVLGWAWTYVIVAELIGSSSGIGHMIIESQALLA
FT                   TGQIIFGIIVIGLIGLASDFLFKAVNRQVFRWKLA"
     MRPLQPVGRV PRAVLGVGFF VLFVLAWAVA TLGGFVPVTF LADPLTMLQD GWLLLTRFGF        60
     LSDIGVTVWR VVGGFLLAAV VAVPLGILMG AYKPVEAFFE PFVSFARYLP ASAFVPLLIL       120
     WAGIGEMQKL LVIFIGSVFQ IVLMVAVSVG QVRRDLVEAA YTLGASDTGI IRRVLIPATA       180
     PDIAEILRLV LGWAWTYVIV AELIGSSSGI GHMIIESQAL LATGQIIFGI IVIGLIGLAS       240
     DFLFKAVNRQ VFRWKLA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page