(data stored in ACNUC7421 zone)

EMBL: CP001349.PE319

CP001349.PE319       Location/Qualifiers
FT   CDS             371306..372100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0327"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2275 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55371"
FT                   /db_xref="GOA:B8IAX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55371.1"
FT                   /translation="MSAPAAVAIEGVSRVFPGMGGRAPLRALDPTDLTVAANDFITILG
FT                   PSGCGKSTLLRIVAGLDLPSSGRVLVGGREVRRAGPDRGMVFQSYTLFPWLTVAENIAF
FT                   GLRERGVPMSERREIVAAYIDKVGLRGFEGHYPKQLSGGMQQRTAIARALANDPAILLL
FT                   DEPFGALDNQTRGLMQELLLGIWERERKTVIFVTHDIEEAVFMASRVVVMTARPGRIKA
FT                   DVPVDLAHPRHYTVKTSPAFSDLKARLTEEIRSEAVLAALEH"
     MSAPAAVAIE GVSRVFPGMG GRAPLRALDP TDLTVAANDF ITILGPSGCG KSTLLRIVAG        60
     LDLPSSGRVL VGGREVRRAG PDRGMVFQSY TLFPWLTVAE NIAFGLRERG VPMSERREIV       120
     AAYIDKVGLR GFEGHYPKQL SGGMQQRTAI ARALANDPAI LLLDEPFGAL DNQTRGLMQE       180
     LLLGIWERER KTVIFVTHDI EEAVFMASRV VVMTARPGRI KADVPVDLAH PRHYTVKTSP       240
     AFSDLKARLT EEIRSEAVLA ALEH                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page