(data stored in ACNUC7421 zone)

EMBL: CP001349.PE32

CP001349.PE32        Location/Qualifiers
FT   CDS             32653..34866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0033"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: met:M446_0031 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55084"
FT                   /db_xref="GOA:B8IT22"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT22"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACL55084.1"
FT                   /translation="MMRQYELVERVKAYNPAADEAMLNRAYVYAMRAHGSQMRASGDLF
FT                   FAHPLEVAAILTELRVDDATIVAAVLHDTVEDTAATLEEINRTFTPEIGTLVDGLTKIK
FT                   RLDLVSKQAAQGENFRKLLLAIAADVRVLLVKLADRLHNMRTLHHMPPEKRVRIAQETL
FT                   DIYAPLAGRMGMQELREELEDLSFRNLKPDVYATISKRLDDLTTKSESLVESIERDLVQ
FT                   RLAAKGITAQVRGRQKRPYSIWSKMERKSVAFEQLSDIFGFRVVVDSVDTCYRALGVVH
FT                   TTWPMVPGRYKDYISTPKQNDYRSIHTTVIGPKSQRVELQIRTAEMDEVAEYGIAAHAL
FT                   YKDGSPHLATESGAYQWLRRTIELLAEGDSPEEFLEHTKLELFQDQVFCFTPKGRLIAL
FT                   PRGATPIDFAYAVHTELGNAAVGAKINGRIAPLLTELQNGDEVEIVRADGQTPPAAWES
FT                   LVVTGKARAAIRRATRSAVRRQYAGLGRQILDRAFERAGKNFSDEKLRGALPRLARTSA
FT                   EDVFAAVGRGEMFSGDVVKAVYPDYKDERRSQSAATGPKPHVNGAGRLSLDKDQTVRLT
FT                   WPGKGRGEEDEGAIPIRGLDRDLPVRFAPEGGAVPGDRIVGILTPGEGVTIYPIQSPAL
FT                   AAFDNEPDRWLDVRWDVDGGSNQRFPARIALQSINEPGSFAQIAQVIADHDGNIDNISM
FT                   KRRSQDFTDVLIDLSVWDLKHLNAIVSELRAKRVVSRVERVNG"
     MMRQYELVER VKAYNPAADE AMLNRAYVYA MRAHGSQMRA SGDLFFAHPL EVAAILTELR        60
     VDDATIVAAV LHDTVEDTAA TLEEINRTFT PEIGTLVDGL TKIKRLDLVS KQAAQGENFR       120
     KLLLAIAADV RVLLVKLADR LHNMRTLHHM PPEKRVRIAQ ETLDIYAPLA GRMGMQELRE       180
     ELEDLSFRNL KPDVYATISK RLDDLTTKSE SLVESIERDL VQRLAAKGIT AQVRGRQKRP       240
     YSIWSKMERK SVAFEQLSDI FGFRVVVDSV DTCYRALGVV HTTWPMVPGR YKDYISTPKQ       300
     NDYRSIHTTV IGPKSQRVEL QIRTAEMDEV AEYGIAAHAL YKDGSPHLAT ESGAYQWLRR       360
     TIELLAEGDS PEEFLEHTKL ELFQDQVFCF TPKGRLIALP RGATPIDFAY AVHTELGNAA       420
     VGAKINGRIA PLLTELQNGD EVEIVRADGQ TPPAAWESLV VTGKARAAIR RATRSAVRRQ       480
     YAGLGRQILD RAFERAGKNF SDEKLRGALP RLARTSAEDV FAAVGRGEMF SGDVVKAVYP       540
     DYKDERRSQS AATGPKPHVN GAGRLSLDKD QTVRLTWPGK GRGEEDEGAI PIRGLDRDLP       600
     VRFAPEGGAV PGDRIVGILT PGEGVTIYPI QSPALAAFDN EPDRWLDVRW DVDGGSNQRF       660
     PARIALQSIN EPGSFAQIAQ VIADHDGNID NISMKRRSQD FTDVLIDLSV WDLKHLNAIV       720
     SELRAKRVVS RVERVNG                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page