(data stored in ACNUC7421 zone)

EMBL: CP001349.PE320

CP001349.PE320       Location/Qualifiers
FT   CDS             372241..373464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0328"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_2274 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55372"
FT                   /db_xref="GOA:B8IAX9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX9"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55372.1"
FT                   /translation="MGGIVVVGTGQGGFQLGASLREGGYQGPVTLIGDEPGLPYGRPPL
FT                   SKAYLMGKTDAAGLLLRAPGYYAEHGLTIRSGERVAALDRAAQRVELASGERLPFDHLV
FT                   LATGARNRPLPVPGADLPGVHQLRSLAEADALKAALAGVTRVAVVGAGFIGLEFAAVCS
FT                   SKGLSVTVIEGLDRALARAVSPIMAGAITASHEAAGARLLFGAQVEAIAGRERATGVVI
FT                   RGGGTVEADLVLIGIGVLPNQDLAEAAGLPMGNGIEVDAMLSTADPAVSAIGDCASHPS
FT                   PHADGARVRLESVQNAVDGARCVAARLTGRPAAYTAVPWFWSDQGPLKLQIAGLSTPAD
FT                   AAVTRGAPGASFSVFRYREGRLVCVESLNRPADHMIARRLLQAGTSLSPEQAADPGFDL
FT                   KAFALTSA"
     MGGIVVVGTG QGGFQLGASL REGGYQGPVT LIGDEPGLPY GRPPLSKAYL MGKTDAAGLL        60
     LRAPGYYAEH GLTIRSGERV AALDRAAQRV ELASGERLPF DHLVLATGAR NRPLPVPGAD       120
     LPGVHQLRSL AEADALKAAL AGVTRVAVVG AGFIGLEFAA VCSSKGLSVT VIEGLDRALA       180
     RAVSPIMAGA ITASHEAAGA RLLFGAQVEA IAGRERATGV VIRGGGTVEA DLVLIGIGVL       240
     PNQDLAEAAG LPMGNGIEVD AMLSTADPAV SAIGDCASHP SPHADGARVR LESVQNAVDG       300
     ARCVAARLTG RPAAYTAVPW FWSDQGPLKL QIAGLSTPAD AAVTRGAPGA SFSVFRYREG       360
     RLVCVESLNR PADHMIARRL LQAGTSLSPE QAADPGFDLK AFALTSA                     407
//

If you have problems or comments...

PBIL Back to PBIL home page