(data stored in ACNUC7421 zone)

EMBL: CP001349.PE322

CP001349.PE322       Location/Qualifiers
FT   CDS             374046..374534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0330"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: met:M446_2272 protein of unknown function
FT                   DUF306 MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55374"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY1"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACL55374.1"
FT                   /translation="MMAMRMAAAAGAVALVAFATQASAQAILGYGQKNRDKPDQKQYIP
FT                   PAKAQEKIFPLDSTWTAVSLNGRPFAGADRPSFIIDKQYRARGFGGCNTFAATAFPLKE
FT                   QHLAVGPLAITKKSCDKAVSAAEMQFFTAFRTSAQWDIVGSQLVIKSQAGELRFDRAL"
     MMAMRMAAAA GAVALVAFAT QASAQAILGY GQKNRDKPDQ KQYIPPAKAQ EKIFPLDSTW        60
     TAVSLNGRPF AGADRPSFII DKQYRARGFG GCNTFAATAF PLKEQHLAVG PLAITKKSCD       120
     KAVSAAEMQF FTAFRTSAQW DIVGSQLVIK SQAGELRFDR AL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page