(data stored in ACNUC7421 zone)

EMBL: CP001349.PE323

CP001349.PE323       Location/Qualifiers
FT   CDS             374787..375920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0331"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_2271 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55375"
FT                   /db_xref="GOA:B8IAY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY2"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55375.1"
FT                   /translation="MRVLMRGLVAAALLAGAVTGAAAQDKTPVKLGAIEILTGPNSRYG
FT                   IAIQRGFDLAAAEINKGGGVLGGRPLALVYEDSAGAKEQALNAARKLIGRDKVPLILGP
FT                   TLSNEMFAAGPVANERKVPIVGTSTTANGITAIGPYVFRTSLPEADVIPVTLRTAKEKF
FT                   GIKRVAVMYGNDDAFTKSAYDVMKGALDKLGIEVLTTETFGSKDTDFSAQLTKIKGLNP
FT                   DAIVLSALVEAASGIALQARQLGIDPKVFIIGGNGLNSPKLGEIAGAAADGTIVGSPWF
FT                   IGKKDPANQAFVASFREKYGDSPDQFAAQAYDTLFIVAKAIDAAGAPESEKIKDALIKV
FT                   KHTGVMGPFSFSESRDPADTSGVVVLTMKGGKFQLLE"
     MRVLMRGLVA AALLAGAVTG AAAQDKTPVK LGAIEILTGP NSRYGIAIQR GFDLAAAEIN        60
     KGGGVLGGRP LALVYEDSAG AKEQALNAAR KLIGRDKVPL ILGPTLSNEM FAAGPVANER       120
     KVPIVGTSTT ANGITAIGPY VFRTSLPEAD VIPVTLRTAK EKFGIKRVAV MYGNDDAFTK       180
     SAYDVMKGAL DKLGIEVLTT ETFGSKDTDF SAQLTKIKGL NPDAIVLSAL VEAASGIALQ       240
     ARQLGIDPKV FIIGGNGLNS PKLGEIAGAA ADGTIVGSPW FIGKKDPANQ AFVASFREKY       300
     GDSPDQFAAQ AYDTLFIVAK AIDAAGAPES EKIKDALIKV KHTGVMGPFS FSESRDPADT       360
     SGVVVLTMKG GKFQLLE                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page