(data stored in ACNUC7421 zone)

EMBL: CP001349.PE324

CP001349.PE324       Location/Qualifiers
FT   CDS             376143..377024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0332"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2270 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55376"
FT                   /db_xref="GOA:B8IAY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55376.1"
FT                   /translation="MLEQQLVNGVVLGATYALFAIGFTLMFGVMGVINLTYGVYFAIGA
FT                   FAALWSTQSLNLGIAAALPVGALVAGLIAVAIDTALLTRLRKAKAPELASLMVTLGATL
FT                   FLYAGLAAWLGTEIRRFPAAIFEGGAYSLGSIRIGTTQILIVGAAIAFVIALMALVRGS
FT                   RLGLAIRAVAENPDAAALMGINGGLMLRVVSFLSGAIGGAAGVLVGLNFNAIQPFMGEH
FT                   MMLRGFAVIIVGGLGDLRGALVAGLLLGFAEVLTAAYLSSTFKDLTAFALLVATLWFRP
FT                   MGLFGRAAAKRA"
     MLEQQLVNGV VLGATYALFA IGFTLMFGVM GVINLTYGVY FAIGAFAALW STQSLNLGIA        60
     AALPVGALVA GLIAVAIDTA LLTRLRKAKA PELASLMVTL GATLFLYAGL AAWLGTEIRR       120
     FPAAIFEGGA YSLGSIRIGT TQILIVGAAI AFVIALMALV RGSRLGLAIR AVAENPDAAA       180
     LMGINGGLML RVVSFLSGAI GGAAGVLVGL NFNAIQPFMG EHMMLRGFAV IIVGGLGDLR       240
     GALVAGLLLG FAEVLTAAYL SSTFKDLTAF ALLVATLWFR PMGLFGRAAA KRA              293
//

If you have problems or comments...

PBIL Back to PBIL home page