(data stored in ACNUC7421 zone)

EMBL: CP001349.PE325

CP001349.PE325       Location/Qualifiers
FT   CDS             377030..377875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0333"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2269 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55377"
FT                   /db_xref="GOA:B8IAY4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55377.1"
FT                   /translation="MWEALDDFYWTYQSLIHGIGVNGLLALSIYVVLAVGQLSLGQAAF
FT                   MGVGAYTGALLTVKFGTPFAVSMAAAAAVPALIALVVGGPTLRLTGVYLAIATIGLGEI
FT                   TRIVFLNWDYAGGALGLSGIPERGGVGAIYGTLAVVLVGLILVARSRVGRAMEAMREDE
FT                   AAAGVMGVNLPRYRMTALVVSSALAGIAGCLSAHVSSFIGPNEYGFETAVTILSYALLG
FT                   GIGSPVAPVLGAAILTLLPEVLRPLADFRLMVNGLIIVIAVLFMPRGILPWRIARTGAR
FT                   "
     MWEALDDFYW TYQSLIHGIG VNGLLALSIY VVLAVGQLSL GQAAFMGVGA YTGALLTVKF        60
     GTPFAVSMAA AAAVPALIAL VVGGPTLRLT GVYLAIATIG LGEITRIVFL NWDYAGGALG       120
     LSGIPERGGV GAIYGTLAVV LVGLILVARS RVGRAMEAMR EDEAAAGVMG VNLPRYRMTA       180
     LVVSSALAGI AGCLSAHVSS FIGPNEYGFE TAVTILSYAL LGGIGSPVAP VLGAAILTLL       240
     PEVLRPLADF RLMVNGLIIV IAVLFMPRGI LPWRIARTGA R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page