(data stored in ACNUC7421 zone)

EMBL: CP001349.PE326

CP001349.PE326       Location/Qualifiers
FT   CDS             377872..378672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2268 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55378"
FT                   /db_xref="GOA:B8IAY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55378.1"
FT                   /translation="MSMPAPSLLVAEGLTRRFQGLVAVDGVDLAVREGNVHGLIGPNGA
FT                   GKTTLFNLLSGVLAPTAGSVRLDGRALDGLPPYRRTALGLARTFQNIRIFTEMTVLENV
FT                   MTGMHARLSSGLGILLRSPGFRAEERAAKARARELLAFVGLAEAAERRAGSLPYGDQRR
FT                   LEIARALACEPRLVLLDEPAAGMNPADTHALLGLLRRLRDERGLTLLLVEHDMPLVMSL
FT                   CDRLTVLNFGRRIADGTPAEVRAHPAVIEAYLGTKAAIPQGAAS"
     MSMPAPSLLV AEGLTRRFQG LVAVDGVDLA VREGNVHGLI GPNGAGKTTL FNLLSGVLAP        60
     TAGSVRLDGR ALDGLPPYRR TALGLARTFQ NIRIFTEMTV LENVMTGMHA RLSSGLGILL       120
     RSPGFRAEER AAKARARELL AFVGLAEAAE RRAGSLPYGD QRRLEIARAL ACEPRLVLLD       180
     EPAAGMNPAD THALLGLLRR LRDERGLTLL LVEHDMPLVM SLCDRLTVLN FGRRIADGTP       240
     AEVRAHPAVI EAYLGTKAAI PQGAAS                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page