(data stored in ACNUC7421 zone)

EMBL: CP001349.PE327

CP001349.PE327       Location/Qualifiers
FT   CDS             378669..379418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0335"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2267 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55379"
FT                   /db_xref="GOA:B8IAY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55379.1"
FT                   /translation="MSALLSVTGLRLGYGRADVVHGLDLTVTEGRIVSLIGSNGAGKTT
FT                   ILRGLSGLLKPRAGEIRWGGQAGEGTSGGNLPGLDLAGEPAHRIARRGIVQVPEGRQVF
FT                   ANMTVAENLRLGAYRASHAEAARRQQAVVARFPRLGERLSQQAGYLSGGEQQMLAMGRA
FT                   LMAEPKLLLLDEPSMGLAPLIVDEIFSIIAALRAEGRTILLVEQNAGAALAIADDAYVL
FT                   ETGRIRLQGPAAEVARNPEVAAAYLGL"
     MSALLSVTGL RLGYGRADVV HGLDLTVTEG RIVSLIGSNG AGKTTILRGL SGLLKPRAGE        60
     IRWGGQAGEG TSGGNLPGLD LAGEPAHRIA RRGIVQVPEG RQVFANMTVA ENLRLGAYRA       120
     SHAEAARRQQ AVVARFPRLG ERLSQQAGYL SGGEQQMLAM GRALMAEPKL LLLDEPSMGL       180
     APLIVDEIFS IIAALRAEGR TILLVEQNAG AALAIADDAY VLETGRIRLQ GPAAEVARNP       240
     EVAAAYLGL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page