(data stored in ACNUC7421 zone)

EMBL: CP001349.PE328

CP001349.PE328       Location/Qualifiers
FT   CDS             379557..380714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0336"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55380"
FT                   /db_xref="GOA:B8IAY7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55380.1"
FT                   /translation="MRERVVPWQEVSVIDNRAEFVGLAQQEAANVAALCRRFGISRKTG
FT                   YKWLGRARSGAGLDDRSRRPHASPARTSPEMEEAVLELRTAHPSWGGRKLRRRLQDQGQ
FT                   EVVPAASTITAVLARHARLGQPDAPSIPFTRFEHPRPNALWQMDFKGHFAHAGGRCHPL
FT                   TVLDDHSRYALCLAACADEVTATVQGQLSATFRRYGLPERINLDNGSPWGNGPGQRYTP
FT                   LTVWLLRLGIHISHSRPYHPQTNGKDEGFHRTLKRDVLHGAFYASLAACQRAFDRFRLI
FT                   YNCSSERTSRYAVDAKRLCCAGSGTAGCLLRFSVPCARARAAGLSRAARLNTQGPSARG
FT                   CTASTSPRSAARRSVRAATPTRAAAWLRFSQGSSPSAPARNTGMR"
     MRERVVPWQE VSVIDNRAEF VGLAQQEAAN VAALCRRFGI SRKTGYKWLG RARSGAGLDD        60
     RSRRPHASPA RTSPEMEEAV LELRTAHPSW GGRKLRRRLQ DQGQEVVPAA STITAVLARH       120
     ARLGQPDAPS IPFTRFEHPR PNALWQMDFK GHFAHAGGRC HPLTVLDDHS RYALCLAACA       180
     DEVTATVQGQ LSATFRRYGL PERINLDNGS PWGNGPGQRY TPLTVWLLRL GIHISHSRPY       240
     HPQTNGKDEG FHRTLKRDVL HGAFYASLAA CQRAFDRFRL IYNCSSERTS RYAVDAKRLC       300
     CAGSGTAGCL LRFSVPCARA RAAGLSRAAR LNTQGPSARG CTASTSPRSA ARRSVRAATP       360
     TRAAAWLRFS QGSSPSAPAR NTGMR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page