(data stored in ACNUC7421 zone)

EMBL: CP001349.PE329

CP001349.PE329       Location/Qualifiers
FT   CDS             380730..381425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55381"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY8"
FT                   /inference="similar to AA sequence:KEGG:PFDG_03179"
FT                   /protein_id="ACL55381.1"
FT                   /translation="MTRSRVKRLPCPVLTPLRLSTPAITSSRAISASARTASTTSAGVL
FT                   VRWPRRRRGRRCSVWAPPTQCSVSTISARASSRSATASWRTVRTIRFLSRASVVGADQI
FT                   PRRSAASVSSAAGARAGRGVAASCSAMRASQAPTRARARFQRASSSPVTRRFSGSAASY
FT                   CRKARSAAKRAASRSRTMAARASSRRVFACASAARAASTAAGCTTDRSADSTTSSTRRP
FT                   PKAMQFGSP"
     MTRSRVKRLP CPVLTPLRLS TPAITSSRAI SASARTASTT SAGVLVRWPR RRRGRRCSVW        60
     APPTQCSVST ISARASSRSA TASWRTVRTI RFLSRASVVG ADQIPRRSAA SVSSAAGARA       120
     GRGVAASCSA MRASQAPTRA RARFQRASSS PVTRRFSGSA ASYCRKARSA AKRAASRSRT       180
     MAARASSRRV FACASAARAA STAAGCTTDR SADSTTSSTR RPPKAMQFGS P                231
//

If you have problems or comments...

PBIL Back to PBIL home page