(data stored in ACNUC7421 zone)

EMBL: CP001349.PE33

CP001349.PE33        Location/Qualifiers
FT   CDS             35063..35653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0034"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_0032 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55085"
FT                   /db_xref="GOA:B8IT23"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT23"
FT                   /inference="protein motif:TFAM:TIGR01367"
FT                   /protein_id="ACL55085.1"
FT                   /translation="MTPDDLLEEFRAAGALLEGHFILSSGLHSAVFLQKMAIFSDPVRT
FT                   ERVCAGLAALIRARYGAVDIVVSPAIGGIVPGYETARALGARAIFVERDPGGPFQLRRG
FT                   FSIPAGARAVMVEDIVTTGLSSRECLAALKAEPGEIVGAACLIDRSGGRADLGAPLVAL
FT                   ATLDIPNYPADQLPPELAAIPAVKPGSRAMKAS"
     MTPDDLLEEF RAAGALLEGH FILSSGLHSA VFLQKMAIFS DPVRTERVCA GLAALIRARY        60
     GAVDIVVSPA IGGIVPGYET ARALGARAIF VERDPGGPFQ LRRGFSIPAG ARAVMVEDIV       120
     TTGLSSRECL AALKAEPGEI VGAACLIDRS GGRADLGAPL VALATLDIPN YPADQLPPEL       180
     AAIPAVKPGS RAMKAS                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page