(data stored in ACNUC7421 zone)

EMBL: CP001349.PE330

CP001349.PE330       Location/Qualifiers
FT   CDS             complement(381330..382487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0338"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   acr:Acry_3392 resolvase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55382"
FT                   /db_xref="GOA:B8IAY9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY9"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL55382.1"
FT                   /translation="MSAEKIGPQHRARKAVLYVRQSSAHQVQHNRESQALQYAMRERLA
FT                   GLGFAEIEVIDEDLGCSAAGGTPRAGFERMVAEVCLGKVGAVAAREVSRFARNSRDWQQ
FT                   LVEMCRVVDTLLVDQETIYAPRLGNDRLLLGLKGSLNEYELDLLRQRSLAARYEKAHRG
FT                   ELVVAAPVGFIKVGARLEMDPDRRVQAAIRLAIDKVAELGSVRQALLWFLEHGLDLPTR
FT                   VNAGPVVWRRPRYSTLRAFIANPAYGGAYAYGRSRVTASYDAAGAKARARRTPRSEWLA
FT                   LKPGAHEGYVAWERAEAIRAMVSENVPASSRGAPKLGAALLSGLRPLRAQAERAVHGGQ
FT                   GTDPALRLRARADRLRRAELHRLWGPARRRRGGVSAPVCRAAGRG"
     MSAEKIGPQH RARKAVLYVR QSSAHQVQHN RESQALQYAM RERLAGLGFA EIEVIDEDLG        60
     CSAAGGTPRA GFERMVAEVC LGKVGAVAAR EVSRFARNSR DWQQLVEMCR VVDTLLVDQE       120
     TIYAPRLGND RLLLGLKGSL NEYELDLLRQ RSLAARYEKA HRGELVVAAP VGFIKVGARL       180
     EMDPDRRVQA AIRLAIDKVA ELGSVRQALL WFLEHGLDLP TRVNAGPVVW RRPRYSTLRA       240
     FIANPAYGGA YAYGRSRVTA SYDAAGAKAR ARRTPRSEWL ALKPGAHEGY VAWERAEAIR       300
     AMVSENVPAS SRGAPKLGAA LLSGLRPLRA QAERAVHGGQ GTDPALRLRA RADRLRRAEL       360
     HRLWGPARRR RGGVSAPVCR AAGRG                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page