(data stored in ACNUC7421 zone)

EMBL: CP001349.PE333

CP001349.PE333       Location/Qualifiers
FT   CDS             384075..385346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0342"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: met:M446_2265 TRAP transporter solute
FT                   receptor TAXI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55385"
FT                   /db_xref="GOA:B8IAZ2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ2"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ACL55385.1"
FT                   /translation="MMRRHVPITIATLLALLAAGLLVYQWAWLPTTLRVAVGPPGGEDA
FT                   RMIGAVAQSLARGHEDVRLRVMPTSGVAESAAVAGREKADLAVVRSDIGIPASTQTVAI
FT                   LHRDAAVLMTADPALAAVPDLKDRRVGVVRQQVGNAKLLATILEQYEVPPGSVETVPLA
FT                   HGDEAGRALQEGRVDAVFVVAPVTGSTMTEAVASIVRAGLHLTFIPVGEAAAIVRRSPA
FT                   LEAVEVGRGTFGGTPSRPAEAFTTLGVSHRLVAQAKLPDAIVSELTRLLFVTRPAIVGE
FT                   VPLANQIEAPETDKGASLPLHPGAEAYFDGEIETFFERYGDWFYLIVMCLSILGSAAAT
FT                   LVSRAANRSRARDMELLRELLAIVRASRDVENEDDLFGLEHKADEILAAALARAGTGAI
FT                   DNAGVAAFTLGLDQAGGLSPSAAF"
     MMRRHVPITI ATLLALLAAG LLVYQWAWLP TTLRVAVGPP GGEDARMIGA VAQSLARGHE        60
     DVRLRVMPTS GVAESAAVAG REKADLAVVR SDIGIPASTQ TVAILHRDAA VLMTADPALA       120
     AVPDLKDRRV GVVRQQVGNA KLLATILEQY EVPPGSVETV PLAHGDEAGR ALQEGRVDAV       180
     FVVAPVTGST MTEAVASIVR AGLHLTFIPV GEAAAIVRRS PALEAVEVGR GTFGGTPSRP       240
     AEAFTTLGVS HRLVAQAKLP DAIVSELTRL LFVTRPAIVG EVPLANQIEA PETDKGASLP       300
     LHPGAEAYFD GEIETFFERY GDWFYLIVMC LSILGSAAAT LVSRAANRSR ARDMELLREL       360
     LAIVRASRDV ENEDDLFGLE HKADEILAAA LARAGTGAID NAGVAAFTLG LDQAGGLSPS       420
     AAF                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page