(data stored in ACNUC7421 zone)

EMBL: CP001349.PE334

CP001349.PE334       Location/Qualifiers
FT   CDS             385532..387355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0343"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: met:M446_2264 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55386"
FT                   /db_xref="GOA:B8IAZ3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ3"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACL55386.1"
FT                   /translation="MKLRNIAIIAHVDHGKTTLVDKLLQQSGSFRENQRVEERVMDSND
FT                   LEKERGITILAKVTSVVWKDTRVNIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVSKALKIGLRPIVAINKVDRPDARIDEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SGRNGWMATSPDGPQDGMAPLFDLVLDHVPPAKTEDGAFRMLGTLLEANPFLGRIVTGR
FT                   IASGSVKPNQTIKVLDRTGKVVETGRVSKILAFRGLERQPIEVGEAGDIVSVAGLTKGT
FT                   VSDTFCDPSVETPIQAQPIDPPTVTMSFIVNDSPLAGTEGDKVTSRMIRDRLFKEAEGN
FT                   ITLKIEEAADKDSFHVSGRGELQLSILIETMRREGFELAVSRPRVVFEKDEAGNLLEPI
FT                   EEVVIDVDEEHSGVVVQKMSERKGDMLEMRPSGGNRLRLVFHAPTRGLIGYQSELLTDT
FT                   RGTAIMNRLFKAYEPFKGEIPGRRNGVLISNDQGEAVAYALWNLEDRGPMMIEPGWKVY
FT                   QGMIVGEHNRENDLEVNVLKGKKLTNIRTTSKDEAVRLTPPIRMTLERSLAWIQDDELV
FT                   EVTPKSIRLRKTVLDPNDRKRAERSKEALSA"
     MKLRNIAIIA HVDHGKTTLV DKLLQQSGSF RENQRVEERV MDSNDLEKER GITILAKVTS        60
     VVWKDTRVNI VDTPGHADFG GEVERILSMV DGVIVLVDAA EGPMPQTKFV VSKALKIGLR       120
     PIVAINKVDR PDARIDEVVN EVFDLFAALD ATDEQLDFPI LYGSGRNGWM ATSPDGPQDG       180
     MAPLFDLVLD HVPPAKTEDG AFRMLGTLLE ANPFLGRIVT GRIASGSVKP NQTIKVLDRT       240
     GKVVETGRVS KILAFRGLER QPIEVGEAGD IVSVAGLTKG TVSDTFCDPS VETPIQAQPI       300
     DPPTVTMSFI VNDSPLAGTE GDKVTSRMIR DRLFKEAEGN ITLKIEEAAD KDSFHVSGRG       360
     ELQLSILIET MRREGFELAV SRPRVVFEKD EAGNLLEPIE EVVIDVDEEH SGVVVQKMSE       420
     RKGDMLEMRP SGGNRLRLVF HAPTRGLIGY QSELLTDTRG TAIMNRLFKA YEPFKGEIPG       480
     RRNGVLISND QGEAVAYALW NLEDRGPMMI EPGWKVYQGM IVGEHNREND LEVNVLKGKK       540
     LTNIRTTSKD EAVRLTPPIR MTLERSLAWI QDDELVEVTP KSIRLRKTVL DPNDRKRAER       600
     SKEALSA                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page