(data stored in ACNUC7421 zone)

EMBL: CP001349.PE335

CP001349.PE335       Location/Qualifiers
FT   CDS             complement(387652..389091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0344"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   mex:Mext_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55387"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ4"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ACL55387.1"
FT                   /translation="MPARPSRRHAELGPDFYDVVAPARFPQAIIRHRNQAWAARVGLGG
FT                   LTDEEWIAHFARFEPMEGSFPEPLALRYHGHQFRSYNPDLGDGRGFLFAQLHDLRDGRL
FT                   LDLGTKGSGQTPYSRFADGRLTLKGGLREVLATTMLEALGVDTSKSFSLIETGESLERS
FT                   DEPSPTRASVLVRLSHSHIRIGSFQRPRALGRTEEIRRLLDHTIRTYMPGLWHEDVGTR
FT                   AASFLAEVCRLVVRTGAQWMAAGFVHGVLNTDNINVTGESFDYGPWRFAPVNDPGFTAA
FT                   YFDEFGLYAFGRQPEALAWNLGRLAECLLPLSDIDRLGAALDVIGPSLQDSFAEAILRR
FT                   LGLARPEDEDRLHALVGAFWAFLRESRAPFEQVFFDWYGGSLSTARAARSPAAEHYAGE
FT                   TFARVRDLLPAFAPAPDIRLDHPYFARSTPCTMLIDEVEAVWAPIAERDDWSAYEAKMR
FT                   AIAEMAEAYGTAPQAVGDPAA"
     MPARPSRRHA ELGPDFYDVV APARFPQAII RHRNQAWAAR VGLGGLTDEE WIAHFARFEP        60
     MEGSFPEPLA LRYHGHQFRS YNPDLGDGRG FLFAQLHDLR DGRLLDLGTK GSGQTPYSRF       120
     ADGRLTLKGG LREVLATTML EALGVDTSKS FSLIETGESL ERSDEPSPTR ASVLVRLSHS       180
     HIRIGSFQRP RALGRTEEIR RLLDHTIRTY MPGLWHEDVG TRAASFLAEV CRLVVRTGAQ       240
     WMAAGFVHGV LNTDNINVTG ESFDYGPWRF APVNDPGFTA AYFDEFGLYA FGRQPEALAW       300
     NLGRLAECLL PLSDIDRLGA ALDVIGPSLQ DSFAEAILRR LGLARPEDED RLHALVGAFW       360
     AFLRESRAPF EQVFFDWYGG SLSTARAARS PAAEHYAGET FARVRDLLPA FAPAPDIRLD       420
     HPYFARSTPC TMLIDEVEAV WAPIAERDDW SAYEAKMRAI AEMAEAYGTA PQAVGDPAA        479
//

If you have problems or comments...

PBIL Back to PBIL home page