(data stored in ACNUC7421 zone)

EMBL: CP001349.PE336

CP001349.PE336       Location/Qualifiers
FT   CDS             complement(389161..389847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0345"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: met:M446_2263
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55388"
FT                   /db_xref="GOA:B8IAZ5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ5"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL55388.1"
FT                   /translation="MADDSFDSVATAIRTRRAVRAFRSDPVPRETVTALLDLAAQAPSG
FT                   SNMQPWRAYAVAGKARARLCEAVVAAYLAGEKGEPAARYYPEEFFEPYRTRRRRVGLGL
FT                   YALVGIPKGDAARMQAQHARNFRFFDAPVGLIFTIDRRLATGSWLDYGGFLQTLMIAAR
FT                   ARGLDTCPQAAFAPFDAVIRRHLPLGPDEAVVCGMALGYADPQAPENRLVPEREPAAGF
FT                   ATLLGF"
     MADDSFDSVA TAIRTRRAVR AFRSDPVPRE TVTALLDLAA QAPSGSNMQP WRAYAVAGKA        60
     RARLCEAVVA AYLAGEKGEP AARYYPEEFF EPYRTRRRRV GLGLYALVGI PKGDAARMQA       120
     QHARNFRFFD APVGLIFTID RRLATGSWLD YGGFLQTLMI AARARGLDTC PQAAFAPFDA       180
     VIRRHLPLGP DEAVVCGMAL GYADPQAPEN RLVPEREPAA GFATLLGF                    228
//

If you have problems or comments...

PBIL Back to PBIL home page