(data stored in ACNUC7421 zone)

EMBL: CP001349.PE337

CP001349.PE337       Location/Qualifiers
FT   CDS             390146..390874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0346"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; KEGG:
FT                   met:M446_2262 cold-shock DNA-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55389"
FT                   /db_xref="GOA:B8IAZ6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACL55389.1"
FT                   /translation="MGRGRDFREPRRRGFDDGAPEPRWPDQAPSGGGYGGGGGGYGGGF
FT                   GGGFDRGPSRSSIPSGPERDATVKWFNKEKGFGFVELGDGSGDAFLHIRAVEAAGHTDL
FT                   LPGTRLTVQTAQGQKGPQVTNITSVDTSTAEAPAARGPRPPRAGGFGGGGGYGGGGGGG
FT                   GGGRFASGPATEMSGTVKWYDPAKGFGFVSVKDGGKDVFVHRSALARAGLDSLAEGQQV
FT                   TMDVVEGQKGREAQSISVAE"
     MGRGRDFREP RRRGFDDGAP EPRWPDQAPS GGGYGGGGGG YGGGFGGGFD RGPSRSSIPS        60
     GPERDATVKW FNKEKGFGFV ELGDGSGDAF LHIRAVEAAG HTDLLPGTRL TVQTAQGQKG       120
     PQVTNITSVD TSTAEAPAAR GPRPPRAGGF GGGGGYGGGG GGGGGGRFAS GPATEMSGTV       180
     KWYDPAKGFG FVSVKDGGKD VFVHRSALAR AGLDSLAEGQ QVTMDVVEGQ KGREAQSISV       240
     AE                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page