(data stored in ACNUC7421 zone)

EMBL: CP001349.PE338

CP001349.PE338       Location/Qualifiers
FT   CDS             390883..391185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55390"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55390.1"
FT                   /translation="MSKLFAKRRFLGAAASCVLGLAAGAARAEDFTGFYAGVNVGYGRS
FT                   LGDGDGRMTRPGALPSPAGDATALPPSAARAATGNPALRPRGRGPTISASSGARP"
     MSKLFAKRRF LGAAASCVLG LAAGAARAED FTGFYAGVNV GYGRSLGDGD GRMTRPGALP        60
     SPAGDATALP PSAARAATGN PALRPRGRGP TISASSGARP                             100
//

If you have problems or comments...

PBIL Back to PBIL home page