(data stored in ACNUC7421 zone)

EMBL: CP001349.PE339

CP001349.PE339       Location/Qualifiers
FT   CDS             complement(391151..391420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55391"
FT                   /db_xref="GOA:B8IAZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ8"
FT                   /inference="similar to AA sequence:KEGG:M446_2261"
FT                   /protein_id="ACL55391.1"
FT                   /translation="MTGDLNEEPLAPATAVAPPPKLTRREMRRQRRRRRIIGEEILAWI
FT                   LVPLILIAGYWALSGGLAFFGTTPSAVFDQLLQVKDALQKKQKS"
     MTGDLNEEPL APATAVAPPP KLTRREMRRQ RRRRRIIGEE ILAWILVPLI LIAGYWALSG        60
     GLAFFGTTPS AVFDQLLQVK DALQKKQKS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page