(data stored in ACNUC7421 zone)

EMBL: CP001349.PE34

CP001349.PE34        Location/Qualifiers
FT   CDS             35854..36513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0035"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   met:M446_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55086"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT24"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACL55086.1"
FT                   /translation="MTYQRSALFIDGANVYATTKALGFDIDYRKLLADFKARENLIRAF
FT                   YYTALVEDQEYSSIRPLIDWLDYNGYRVVTKPAKEFTDSSGRRKVKGNMDIELTIDALE
FT                   LSPYIDHMVLFSGDGDFKPLVAAMQRRGVRVTVVSTIQTQPPMVADDLRRQADDFVDIV
FT                   HLIPRIGRDQSDRPTRPLRPAPAGEGLRENGERSPVRPSATLEQRYGIRQDETEED"
     MTYQRSALFI DGANVYATTK ALGFDIDYRK LLADFKAREN LIRAFYYTAL VEDQEYSSIR        60
     PLIDWLDYNG YRVVTKPAKE FTDSSGRRKV KGNMDIELTI DALELSPYID HMVLFSGDGD       120
     FKPLVAAMQR RGVRVTVVST IQTQPPMVAD DLRRQADDFV DIVHLIPRIG RDQSDRPTRP       180
     LRPAPAGEGL RENGERSPVR PSATLEQRYG IRQDETEED                              219
//

If you have problems or comments...

PBIL Back to PBIL home page