(data stored in ACNUC7421 zone)

EMBL: CP001349.PE340

CP001349.PE340       Location/Qualifiers
FT   CDS             complement(391587..394040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0349"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="KEGG: met:M446_2260 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpA; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit clpA; PFAM: AAA ATPase
FT                   central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; ATP-dependent Clp protease
FT                   ATP-binding subunit clpA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55392"
FT                   /db_xref="GOA:B8IAZ9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ9"
FT                   /inference="protein motif:TFAM:TIGR02639"
FT                   /protein_id="ACL55392.1"
FT                   /translation="MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAV
FT                   MRACNVDVELLKRNLIEYIDTELANLTGDGRQDAKPTAGFQRVIQRAVIHVQSSGREEV
FT                   TGANVLVAIFAERESHAAYFLQEQDMTRYDAVNYISHGIAKRPGLSEAKPVRGAEEEGG
FT                   SERPSGGEDERGPKKKGDALDAYCVNLNKKAREGKIDPLIGREAEVQRTIQVLCRRQKN
FT                   NPLLVGDPGVGKTAIAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERL
FT                   KQVMKEIEAHPNAIMFIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKE
FT                   YRQYFEKDRALVRRFQKIDVNEPSIPDAIEILKGLRPYFEEFHKLKYTTDAVKAAVELS
FT                   ARYISDRKLPDKAIDVIDETGASQMLVPESRRKRTIGVKEVEATIATMARIPPKTVSKD
FT                   DAVVLANLTDSLKRVVYGQDSAIEALTASIKLARAGLRDPDKPIGSYLFAGPTGVGKTE
FT                   VAKQLAVALGVEMLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLL
FT                   LDEIEKAHPDLFNILLQVMDHGKLTDHNGKQVDFRNVIIIMTSNAGAQDLARAAFGFTQ
FT                   SKRTGDDQEAINRLFAPEFRNRLDAIVSFGHLPREVVSKVVDKFVLQLEAQLADRNVTI
FT                   ELSDEAREWLVENGYDETMGARPMARLIQSTIKTPLADEVLFGKLKDGGAVRVVVKRPE
FT                   TGKPSLGFEFPAGPVTPKPEKDVTNAAKKKRSRPRAAPKKPKDNGGPGGSGGVRTVPKV
FT                   PLVRA"
     MPSFSRSLEQ ALHRALALAG ERRHEYATLE HLLLALVDDQ DAAAVMRACN VDVELLKRNL        60
     IEYIDTELAN LTGDGRQDAK PTAGFQRVIQ RAVIHVQSSG REEVTGANVL VAIFAERESH       120
     AAYFLQEQDM TRYDAVNYIS HGIAKRPGLS EAKPVRGAEE EGGSERPSGG EDERGPKKKG       180
     DALDAYCVNL NKKAREGKID PLIGREAEVQ RTIQVLCRRQ KNNPLLVGDP GVGKTAIAEG       240
     LARKIIQHEV PEVLADATVF SLDMGTLLAG TRYRGDFEER LKQVMKEIEA HPNAIMFIDE       300
     IHTVIGAGAT SGGAMDASNL LKPALASGTL RCIGSTTYKE YRQYFEKDRA LVRRFQKIDV       360
     NEPSIPDAIE ILKGLRPYFE EFHKLKYTTD AVKAAVELSA RYISDRKLPD KAIDVIDETG       420
     ASQMLVPESR RKRTIGVKEV EATIATMARI PPKTVSKDDA VVLANLTDSL KRVVYGQDSA       480
     IEALTASIKL ARAGLRDPDK PIGSYLFAGP TGVGKTEVAK QLAVALGVEM LRFDMSEYME       540
     RHTVSRLIGA PPGYVGFDQG GLLTDGVDQH PHCVLLLDEI EKAHPDLFNI LLQVMDHGKL       600
     TDHNGKQVDF RNVIIIMTSN AGAQDLARAA FGFTQSKRTG DDQEAINRLF APEFRNRLDA       660
     IVSFGHLPRE VVSKVVDKFV LQLEAQLADR NVTIELSDEA REWLVENGYD ETMGARPMAR       720
     LIQSTIKTPL ADEVLFGKLK DGGAVRVVVK RPETGKPSLG FEFPAGPVTP KPEKDVTNAA       780
     KKKRSRPRAA PKKPKDNGGP GGSGGVRTVP KVPLVRA                                817
//

If you have problems or comments...

PBIL Back to PBIL home page