(data stored in ACNUC7421 zone)

EMBL: CP001349.PE341

CP001349.PE341       Location/Qualifiers
FT   CDS             complement(394062..394469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0350"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: met:M446_2259 ATP-dependent Clp protease
FT                   adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55393"
FT                   /db_xref="GOA:B8IB00"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB00"
FT                   /inference="protein motif:PFAM:PF02617"
FT                   /protein_id="ACL55393.1"
FT                   /translation="MSQVPRQDIVVIKRAAAAEIVAASPRAPGNGGNGGDGRSGTAVIT
FT                   RTRPITKRPNLYRVLLLNDDYTPMEFVVHVVERFFNKSREDATRIMLHVHQNGVGECGV
FT                   FTYEVAETKVTQVMDFARKHQHPLQCVMEKK"
     MSQVPRQDIV VIKRAAAAEI VAASPRAPGN GGNGGDGRSG TAVITRTRPI TKRPNLYRVL        60
     LLNDDYTPME FVVHVVERFF NKSREDATRI MLHVHQNGVG ECGVFTYEVA ETKVTQVMDF       120
     ARKHQHPLQC VMEKK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page