(data stored in ACNUC7421 zone)

EMBL: CP001349.PE342

CP001349.PE342       Location/Qualifiers
FT   CDS             complement(394791..395129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55394"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB01"
FT                   /inference="similar to AA sequence:KEGG:M446_2258"
FT                   /protein_id="ACL55394.1"
FT                   /translation="MNQQFETAQKYGKESMDSLLRSFGTLSKGSQAIAVEAADFVKQSI
FT                   EQTTATLEKLAGVRSLDKAIEIQTEYLKTSYERFLAQSTKMAELYGNLAKEMVKPLESF
FT                   AAKVPAAA"
     MNQQFETAQK YGKESMDSLL RSFGTLSKGS QAIAVEAADF VKQSIEQTTA TLEKLAGVRS        60
     LDKAIEIQTE YLKTSYERFL AQSTKMAELY GNLAKEMVKP LESFAAKVPA AA               112
//

If you have problems or comments...

PBIL Back to PBIL home page