(data stored in ACNUC7421 zone)

EMBL: CP001349.PE343

CP001349.PE343       Location/Qualifiers
FT   CDS             395421..396917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0352"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Sporulation domain
FT                   protein; KEGG: met:M446_2257 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55395"
FT                   /db_xref="GOA:B8IB02"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB02"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACL55395.1"
FT                   /translation="MRGVRGTSGRAVPALIAAAAILTAMTNPADARRRGHHHGGGGGYN
FT                   PPFAAMVVDVKSGRILHAVNEDALRHPASITKVMTLYLLFEQLERGRMSLDTPLEISAN
FT                   AARQAPSKLGLRPGATITVEEAIKALVTKSANDVACAIGENIAGSEGAFAEMMTRKAHA
FT                   LGMTRTHYANASGLPDSDQITTARDLTILARAIQDRFPRYYRYFQTRSFAFRGRVIGNH
FT                   NHLLGRVEGVDGIKTGYTRDSGFNLMTSARINDRHIVAVVLGGKSVASRDAIMTRLVEA
FT                   NLPKAYAGARTTAPVVEVAERPRPAVVAEKPVATRTLVAAADGEDESIETTASTGRPGQ
FT                   PLDLNPSRQTATPSGGRWRSGSGLPANAQAYAATPDTSFPAPGGKYGSRLPSTEPGEVR
FT                   APAPPARTEAPAPKPVSVTPWVIQLGAMDDEAKAKSMLAEARQRSGGMLAKAAPFTERV
FT                   THGGTTLYRARFSGFSEAESAQDACRALKRNGFTCFATRS"
     MRGVRGTSGR AVPALIAAAA ILTAMTNPAD ARRRGHHHGG GGGYNPPFAA MVVDVKSGRI        60
     LHAVNEDALR HPASITKVMT LYLLFEQLER GRMSLDTPLE ISANAARQAP SKLGLRPGAT       120
     ITVEEAIKAL VTKSANDVAC AIGENIAGSE GAFAEMMTRK AHALGMTRTH YANASGLPDS       180
     DQITTARDLT ILARAIQDRF PRYYRYFQTR SFAFRGRVIG NHNHLLGRVE GVDGIKTGYT       240
     RDSGFNLMTS ARINDRHIVA VVLGGKSVAS RDAIMTRLVE ANLPKAYAGA RTTAPVVEVA       300
     ERPRPAVVAE KPVATRTLVA AADGEDESIE TTASTGRPGQ PLDLNPSRQT ATPSGGRWRS       360
     GSGLPANAQA YAATPDTSFP APGGKYGSRL PSTEPGEVRA PAPPARTEAP APKPVSVTPW       420
     VIQLGAMDDE AKAKSMLAEA RQRSGGMLAK AAPFTERVTH GGTTLYRARF SGFSEAESAQ       480
     DACRALKRNG FTCFATRS                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page