(data stored in ACNUC7421 zone)

EMBL: CP001349.PE344

CP001349.PE344       Location/Qualifiers
FT   CDS             complement(397099..397824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0353"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   met:M446_2256 heat shock protein DnaJ domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55396"
FT                   /db_xref="GOA:B8IB03"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB03"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACL55396.1"
FT                   /translation="MIALGLGVLVLVGLWWLGRQATNANPTLLARVLRRLGGWLALAVA
FT                   AVLFLRGRFDMAIALGLIGGWLLGWSQMPALPFGLGQQGPAPRSPGSTSRVRSMMIEME
FT                   LDHETGAMRGRVLAGPRAGQALDALPLPDLLALLATCRAGDPDGARLLEAYLDRRFAGW
FT                   REHAEGDADARPGAAPQPGAMTEEEAYQILGLERGASVEDVRRAHRTLMKRLHPDQGGS
FT                   DYLAARVNAAKDRLLNRHR"
     MIALGLGVLV LVGLWWLGRQ ATNANPTLLA RVLRRLGGWL ALAVAAVLFL RGRFDMAIAL        60
     GLIGGWLLGW SQMPALPFGL GQQGPAPRSP GSTSRVRSMM IEMELDHETG AMRGRVLAGP       120
     RAGQALDALP LPDLLALLAT CRAGDPDGAR LLEAYLDRRF AGWREHAEGD ADARPGAAPQ       180
     PGAMTEEEAY QILGLERGAS VEDVRRAHRT LMKRLHPDQG GSDYLAARVN AAKDRLLNRH       240
     R                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page