(data stored in ACNUC7421 zone)

EMBL: CP001349.PE345

CP001349.PE345       Location/Qualifiers
FT   CDS             complement(397870..398571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55397"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB04"
FT                   /inference="similar to AA sequence:KEGG:M446_2255"
FT                   /protein_id="ACL55397.1"
FT                   /translation="MGERSVPPVPTGEAAVAAFLGEARRLAPATPAAPRLIFALDATMS
FT                   RQPTWDLACRLQAEMFAATADLGGLAVQLVYFRGFSECRASRFVADPRALTGLMTGIHC
FT                   RGGLTQIGRVLRHARAEAGKGPVKALVLVGDAVEEDLDGLCAVAGELRLLGVPAFCFQE
FT                   GGEPQAATGFAEIARLSGGAHARFDRDAPATLAGLLRAAAVYAARGLDGLRLAAREDAV
FT                   ARRLLGAMTPR"
     MGERSVPPVP TGEAAVAAFL GEARRLAPAT PAAPRLIFAL DATMSRQPTW DLACRLQAEM        60
     FAATADLGGL AVQLVYFRGF SECRASRFVA DPRALTGLMT GIHCRGGLTQ IGRVLRHARA       120
     EAGKGPVKAL VLVGDAVEED LDGLCAVAGE LRLLGVPAFC FQEGGEPQAA TGFAEIARLS       180
     GGAHARFDRD APATLAGLLR AAAVYAARGL DGLRLAARED AVARRLLGAM TPR              233
//

If you have problems or comments...

PBIL Back to PBIL home page