(data stored in ACNUC7421 zone)

EMBL: CP001349.PE346

CP001349.PE346       Location/Qualifiers
FT   CDS             complement(398587..399579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0355"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; KEGG: met:M446_2254
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55398"
FT                   /db_xref="GOA:B8IB05"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB05"
FT                   /inference="protein motif:TFAM:TIGR03438"
FT                   /protein_id="ACL55398.1"
FT                   /translation="MTAPRPHLPPAAPPAEPASRRFAEDVLAGLTAPRKHLAAKYFYDQ
FT                   QGSALFEAITRLPEYYPTRTELGILARHGAEIASALPPGAALVEFGSGSTQKLRRLLPH
FT                   LRDLAAYVPVDVSEEFLRSEAEDLGRDFPALRVAPVAADFTQLFALPPEALGAAARAGF
FT                   FPGSTIGNFEPEAAAALLRHFGATLGPQATLIVGVDLVKDKAVLDAAYDDAAGVTAAFN
FT                   LNLLARINREVGADFDLAAFAHRAFFDTALSRIEMHLVSRQAQRVTVANVPITFAAGET
FT                   IHTENSYKFTVEGFRALARSAGWEGRAVWTDPDGLFSIHALTATSIRRH"
     MTAPRPHLPP AAPPAEPASR RFAEDVLAGL TAPRKHLAAK YFYDQQGSAL FEAITRLPEY        60
     YPTRTELGIL ARHGAEIASA LPPGAALVEF GSGSTQKLRR LLPHLRDLAA YVPVDVSEEF       120
     LRSEAEDLGR DFPALRVAPV AADFTQLFAL PPEALGAAAR AGFFPGSTIG NFEPEAAAAL       180
     LRHFGATLGP QATLIVGVDL VKDKAVLDAA YDDAAGVTAA FNLNLLARIN REVGADFDLA       240
     AFAHRAFFDT ALSRIEMHLV SRQAQRVTVA NVPITFAAGE TIHTENSYKF TVEGFRALAR       300
     SAGWEGRAVW TDPDGLFSIH ALTATSIRRH                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page