(data stored in ACNUC7421 zone)

EMBL: CP001349.PE347

CP001349.PE347       Location/Qualifiers
FT   CDS             complement(399621..400877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0356"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   met:M446_2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55399"
FT                   /db_xref="GOA:B8IB06"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB06"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACL55399.1"
FT                   /translation="MAATATAQATDMRPAFPPPDVSARPVDRSAWIAAFRHVRDETERR
FT                   AAPLSPEDQQIQSMPDASPTKWHRAHTTWFFEQFLLKDRAHGYRIFDERFLYLFNSYYV
FT                   AAGPRAPRVSRGLVTRPTCEEVAAYRDHVDGAVCTLIETAPDAALAEVLAILEIGLHHE
FT                   QQHQELLLTDILHAFAQNPLSPAYDSGWRFPAPPAGGTLWLDGGIVPIGHAGGGFSFDN
FT                   ELPRHEVLLQPVALDRALVTNGEWLDFMQDGGYARPELWLSDGWATAQTEGWEAPGYWR
FT                   QAGDGVWSGMTLAGLKAIDPALPVTHVSYYEADAFARWAGCDLPTEAEWEAAARAGLDG
FT                   AFGHVWQWTRSSYSAYPGYRPVPGALGEYNGKFMVNQFVLRGSSVATPAGHSRATYRNF
FT                   FYPHQRWQFTGLRLSHGRA"
     MAATATAQAT DMRPAFPPPD VSARPVDRSA WIAAFRHVRD ETERRAAPLS PEDQQIQSMP        60
     DASPTKWHRA HTTWFFEQFL LKDRAHGYRI FDERFLYLFN SYYVAAGPRA PRVSRGLVTR       120
     PTCEEVAAYR DHVDGAVCTL IETAPDAALA EVLAILEIGL HHEQQHQELL LTDILHAFAQ       180
     NPLSPAYDSG WRFPAPPAGG TLWLDGGIVP IGHAGGGFSF DNELPRHEVL LQPVALDRAL       240
     VTNGEWLDFM QDGGYARPEL WLSDGWATAQ TEGWEAPGYW RQAGDGVWSG MTLAGLKAID       300
     PALPVTHVSY YEADAFARWA GCDLPTEAEW EAAARAGLDG AFGHVWQWTR SSYSAYPGYR       360
     PVPGALGEYN GKFMVNQFVL RGSSVATPAG HSRATYRNFF YPHQRWQFTG LRLSHGRA         418
//

If you have problems or comments...

PBIL Back to PBIL home page