(data stored in ACNUC7421 zone)

EMBL: CP001349.PE348

CP001349.PE348       Location/Qualifiers
FT   CDS             401055..401993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0357"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: met:M446_2251 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55400"
FT                   /db_xref="GOA:B8IB07"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB07"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACL55400.1"
FT                   /translation="MRFEGMPVQQHGRARPNELMRMRFDLLAGAGAAPLAPAMRAPAVL
FT                   VFDSGLGGLTVLAEVRRARPDARVVYAADDAAFPYGDLSEPALVARVVAVMERLIALHA
FT                   PDLVVVACNTATTLVLPALRARFAIPFVGTVPAIKPAAAATRSGLISVLATPGTVRRDY
FT                   TRELIDAYAGAYAVTLVGATRLAAFAEAELAGTPVGDDLLREEIAPCFVGAGESRTDVV
FT                   VLGCTHYPLLLRRFERLVPWPVTWIDPAPAIARRMAQLLGPAPHPAPPEDAAPVAAVFT
FT                   GGERITPSLRDALAARGMGSIAVEAMPLARQ"
     MRFEGMPVQQ HGRARPNELM RMRFDLLAGA GAAPLAPAMR APAVLVFDSG LGGLTVLAEV        60
     RRARPDARVV YAADDAAFPY GDLSEPALVA RVVAVMERLI ALHAPDLVVV ACNTATTLVL       120
     PALRARFAIP FVGTVPAIKP AAAATRSGLI SVLATPGTVR RDYTRELIDA YAGAYAVTLV       180
     GATRLAAFAE AELAGTPVGD DLLREEIAPC FVGAGESRTD VVVLGCTHYP LLLRRFERLV       240
     PWPVTWIDPA PAIARRMAQL LGPAPHPAPP EDAAPVAAVF TGGERITPSL RDALAARGMG       300
     SIAVEAMPLA RQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page