(data stored in ACNUC7421 zone)

EMBL: CP001349.PE349

CP001349.PE349       Location/Qualifiers
FT   CDS             402005..402817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55401"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB08"
FT                   /inference="similar to AA sequence:KEGG:M446_2250"
FT                   /protein_id="ACL55401.1"
FT                   /translation="MLLGLLLAPVALYGAVGAALWALQRDLIYPGARGLLHGRRDPPPG
FT                   VETISIRTADGETLRALWRAPAPGCGIVVSFHGNASMPEMHAERFVRDPWAAHGWGLIA
FT                   IAYRGYPGSTGRPSESGLIADGLAALAEAGRRAPGTPALLHGHSLGTAVAVAVAAEHPP
FT                   LGLYLEAPFDSMTAMARMRFPFLPTALLRDPYRSDRRIGAVTGPIVIVHGDDDPVIPTK
FT                   FGLRLARAAPAGTRFEVVEGDHVTLLGRKDAEAEALFRAKLPAGCVAG"
     MLLGLLLAPV ALYGAVGAAL WALQRDLIYP GARGLLHGRR DPPPGVETIS IRTADGETLR        60
     ALWRAPAPGC GIVVSFHGNA SMPEMHAERF VRDPWAAHGW GLIAIAYRGY PGSTGRPSES       120
     GLIADGLAAL AEAGRRAPGT PALLHGHSLG TAVAVAVAAE HPPLGLYLEA PFDSMTAMAR       180
     MRFPFLPTAL LRDPYRSDRR IGAVTGPIVI VHGDDDPVIP TKFGLRLARA APAGTRFEVV       240
     EGDHVTLLGR KDAEAEALFR AKLPAGCVAG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page