(data stored in ACNUC7421 zone)

EMBL: CP001349.PE35

CP001349.PE35        Location/Qualifiers
FT   CDS             complement(36708..37649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0036"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_0034 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55087"
FT                   /db_xref="GOA:B8IT25"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT25"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55087.1"
FT                   /translation="MTTPLIALTGATGFIGRHLLRDLTARGYRVRVLLRRPVALPPGAS
FT                   GAVVGDLARPQNMAAALTGVDAVVHSAGLAHAMSGAPEDDYRTFNTEATRGLAQAAARA
FT                   RVRRFVFLSSIRAQSGPSAAGVLTEADAPTPTDAYGRSKLAAEEALAAVDIDFAALRPV
FT                   LVYGPGVKGNMAALLALAARPLPLPLGGLKGRRSIVSVESLADAIATVLHAPGELRRPF
FT                   IVTEAEPLTVPEMLTALRAGLGRPPGLWPVPALLFDAALRLAGRGEVRERLSGSLMARA
FT                   DALGALGWTAPRDSREGLEALARLEVAHPTSG"
     MTTPLIALTG ATGFIGRHLL RDLTARGYRV RVLLRRPVAL PPGASGAVVG DLARPQNMAA        60
     ALTGVDAVVH SAGLAHAMSG APEDDYRTFN TEATRGLAQA AARARVRRFV FLSSIRAQSG       120
     PSAAGVLTEA DAPTPTDAYG RSKLAAEEAL AAVDIDFAAL RPVLVYGPGV KGNMAALLAL       180
     AARPLPLPLG GLKGRRSIVS VESLADAIAT VLHAPGELRR PFIVTEAEPL TVPEMLTALR       240
     AGLGRPPGLW PVPALLFDAA LRLAGRGEVR ERLSGSLMAR ADALGALGWT APRDSREGLE       300
     ALARLEVAHP TSG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page