(data stored in ACNUC7421 zone)

EMBL: CP001349.PE350

CP001349.PE350       Location/Qualifiers
FT   CDS             402995..403612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0359"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: met:M446_2249 RNA-binding S4
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55402"
FT                   /db_xref="GOA:B8IB09"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB09"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACL55402.1"
FT                   /translation="MSKRIQAKHKLDRRMGQNIWGRPKSPVNRREYGPGQHGQRRKGKL
FT                   SDFGTQLRAKQKLKGYYANITEKQFRRYYAEAIRLRGDSGENLIGLLERRLDAVIYRAK
FT                   FVATPFAARQFVNHGHIKVNGQRVNIPSFLVKPGDVIEVKESSKQLEIVVVASQLAERD
FT                   VPDYIEVDHGKMTARFTRVPTLSEVPYPVHMEPNQVIEFYSR"
     MSKRIQAKHK LDRRMGQNIW GRPKSPVNRR EYGPGQHGQR RKGKLSDFGT QLRAKQKLKG        60
     YYANITEKQF RRYYAEAIRL RGDSGENLIG LLERRLDAVI YRAKFVATPF AARQFVNHGH       120
     IKVNGQRVNI PSFLVKPGDV IEVKESSKQL EIVVVASQLA ERDVPDYIEV DHGKMTARFT       180
     RVPTLSEVPY PVHMEPNQVI EFYSR                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page