(data stored in ACNUC7421 zone)

EMBL: CP001349.PE351

CP001349.PE351       Location/Qualifiers
FT   CDS             complement(403728..404474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55403"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB10"
FT                   /inference="similar to AA sequence:KEGG:SACE_5323"
FT                   /protein_id="ACL55403.1"
FT                   /translation="MGKAQSWLLRGLGVLGLLMMCAAGALALTQPAIAALACPGCYGFE
FT                   HLAGRVYVDPAMPAETRAALLEAVAEAPRRLAHFYGSPVSAPRVLACSDEACQQRIGAG
FT                   GARGVAYGSYGLRLSPRGLDRVTVLHELSHAEMVAQLGLIRSLSNDMPAWFDEGVAVLV
FT                   SNDPRDLLPEGTAVSRCRVEPGGPLPADGRDWRHSGAVDNTIYARAACRVLRWTEANGG
FT                   ASAVGRLVEAMAKGRRFPDLYRTLPE"
     MGKAQSWLLR GLGVLGLLMM CAAGALALTQ PAIAALACPG CYGFEHLAGR VYVDPAMPAE        60
     TRAALLEAVA EAPRRLAHFY GSPVSAPRVL ACSDEACQQR IGAGGARGVA YGSYGLRLSP       120
     RGLDRVTVLH ELSHAEMVAQ LGLIRSLSND MPAWFDEGVA VLVSNDPRDL LPEGTAVSRC       180
     RVEPGGPLPA DGRDWRHSGA VDNTIYARAA CRVLRWTEAN GGASAVGRLV EAMAKGRRFP       240
     DLYRTLPE                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page